missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30203128

Invitrogen™ Human NADK (aa 136-222) Control Fragment Recombinant Protein

Product Code. 30203128
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203128

Brand: Invitrogen™ RP106458

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65779 (PA5-65779. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The human trans-activation response (TAR) RNA binding protein 1 (TRBP1) was initially identified as a protein that binds to the HIV-1 TAR RNA and activates the long terminal repeat (LTR) expression in the absence and presence of the viral trans-activator Tat. This binding is enhanced by the presence of co-factors such as elongation factor 1-a (EF-1-a), polypyrimidine tract-binding protein (PTB), and the chaperonin-like protein stimulator of TAR RNA-binding proteins (SRB). TRBP1 may act to disengage RNA polymerase II from TAR during transcriptional elongation if the RNA polymerase stalls at the TAR during transcriptional elongation.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O95544
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 65220
Name Human NADK (aa 136-222) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4432404C02Rik; BC004012; dJ283E3.1; FLJ13052; hypothetical protein LOC513419; LOW QUALITY PROTEIN: NAD kinase; NAD kinase; Nadk; Poly(P)/ATP NAD kinase; ppnk; Putative inorganic polyphosphate/ATP-NAD kinase (Poly(P)/ATP NAD kinase)
Common Name NADK
Gene Symbol NADK
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VYVEKKVLEDPAIASDESFGAVKKKFCTFREDYDDISNQIDFIICLGGDGTLLYASSLFQGSVPPVMAFHLGSLGFLTPFSFENFQS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.