missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30199754

Invitrogen™ Human NALCN (aa 204-265) Control Fragment Recombinant Protein

Artikelnummer. 30199754
Klik for at se tilgængelige muligheder
Quantity:
100 μL
Pakningsstørrelse:
100µL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 30199754

Brand: Invitrogen™ RP95697

Please to purchase this item. Need a web account? Register with us today!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56887 (PA5-56887. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Nalcn is a voltage-independent, cation-nonselective channel which is permeable to sodium, potassium and calcium ions. Nalcn regulates the resting membrane potential and controls neuronal excitability (PubMed:17448995). Neuropeptides such as neurotensin and substance P (SP) stimulate the firing of action potentials by activating NALCN through a SRC family kinases-dependent pathway. In addition to its baseline activity, Nalcn activity is enhanced/modulated by several GPCRs, is required for normal respiratory rhythm and neonatal survival, is involved in systemic osmoregulation by controlling the serum sodium concentration. Nalcn is partly responsible for the substance P-induced depolarization and regulation of the intestinal pace-making activity in the interstitial cells of Cajal. Further, Nalcn plays a critical role in both maintenance of spontaneous firing of substantia nigra pars reticulata (SNr) neurons and physiological modulation of SNr neuron excitability. Diseases associated with NALCN include Congenital contractures of the limbs and face, Hypotonia, Developmental Delay and Hypotonia, Infantile Psychomotor Retardation And Characteristic Facies 1.
TRUSTED_SUSTAINABILITY

Tekniske data

Accession Number Q8IZF0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 259232
Name Human NALCN (aa 204-265) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A530023G15Rik; AI849508; bA430M15.1; brain voltage-gated cation channel; CanIon; CLIFAHDD; FLJ23913; FLJ44659; FLJ44764; Four domain-type voltage-gated ion channel alpha-1 subunit; four repeat voltage-gated ion channel; IHPRF; IHPRF1; INNFD; MGC74524; Nalcn; Nca; Rb21; Rb21-channel; Sodium leak channel non-selective protein; sodium leak channel, non selective; sodium leak channel, non-selective; Vgcnl1; voltage gated channel like 1; voltage gated channel-like protein 1
Common Name NALCN
Gene Symbol NALCN
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TYHCVVNDTKPGNVTWNSLAIPDTHCSPELEEGYQCPPGFKCMDLEDLGLSRQELGYSGFNE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.