missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human NCOA6 (aa 552-682) Control Fragment Recombinant Protein

Product Code. 30193678
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30193678

Brand: Invitrogen™ RP102323

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52071 (PA5-52071. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Nuclear receptor coactivator that directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. Coactivates expression in an agonist- and AF2-dependent manner. Involved in the coactivation of different nuclear receptors, such as for steroids (GR and ERs), retinoids (RARs and RXRs), thyroid hormone (TRs), vitamin D3 (VDR) and prostanoids (PPARs). Probably functions as a general coactivator, rather than just a nuclear receptor coactivator. May also be involved in the coactivation of the NF-kappa-B pathway. May coactivate expression via a remodeling of chromatin and its interaction with histone acetyltransferase proteins.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q14686
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23054
Name Human NCOA6 (aa 552-682) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias activating signal cointegrator 2; activating signal cointegrator-2; AIB3; Amplified in breast cancer protein 3; amplified in breast cancer-3 protein; ASC2; ASC-2; Cancer-amplified transcriptional coactivator ASC-2; KIAA0181; mKIAA0181; NCOA6; Ncoa7; NRC; NRC RAP250; nuclear receptor coactivator 6; Nuclear receptor coactivator RAP250; nuclear receptor-activating protein 250; nuclear receptor-activating protein, 250 kDa; peroxisome proliferator-activated receptor interacting protein; peroxisome proliferator-activated receptor interacting protein,PRIP; peroxisome proliferator-activated receptor-interacting protein; PPAR interacting protein PRIP; PPAR-interacting protein; PRIP; RAP250; thyroid hormone receptor binding protein; thyroid hormone receptor-binding protein; TRBP
Common Name NCOA6
Gene Symbol NCOA6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NQNVQHAGGQGAGPPQNQMQVSHGPPNMMQPSLMGIHGNMNNQQAGTSGVPQVNLSNMQGQPQQGPPSQLMGMHQQIVPSQGQMVQQQGTLNPQNPMILSRAQLMPQGQMMVNPPSQNLGPSPQRMTPPKQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.