missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30194465

Invitrogen™ Human NDUFV3 (aa 176-301) Control Fragment Recombinant Protein

Product Code. 30194465
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194465

Brand: Invitrogen™ RP102241

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (46%), Rat (46%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54216 (PA5-54216. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Located in the mitochondrial inner membrane, mitochondrial complex I is the first and largest enzyme in the electron transport chain of oxidative phosphorylation. By oxidizing NADH that is produced in the Krebs cycle, this complex utilizes the two electrons to reduce ubiquinone to ubiquinol, thereby initiating the passage of electrons to successive complexes and ultimately leading to the reduction of oxygen to water. Mitochondrial complex I consists of over 40 subunits and is of considerable clinical interest since defects in any one of the subunits can lead to various myopathies and neuropathies. As a subunit of mitochondrial complex I, NDUFV3 (NADH dehydrogenase [ubiquinone] flavoprotein 3), also designated NADH-ubiquinone oxidoreductase 9 kDa subunit or CI-9kD, is a 108 amino acid protein that is believed to not be involved in catalysis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P56181
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4731
Name Human NDUFV3 (aa 176-301) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1500032D16Rik; CI-10 k; CI-9 KD; complex I 10 kDa subunit; complex I, mitochondrial respiratory chain, 10-kD subunit; complex I-9 kD; Mipp65; mitochondrial NADH oxidoreductase-like protein; NADH dehydrogenase (ubiquinone) flavoprotein 3; NADH dehydrogenase (ubiquinone) flavoprotein 3, 10 kDa; NADH dehydrogenase (ubiquinone) flavoprotein 3-like; NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial; NADH:ubiquinone oxidoreductase subunit V3; NADH-ubiquinone oxidoreductase 9 kD subunit; NADH-ubiquinone oxidoreductase 9 kDa subunit; NADH-ubiquinone oxidoreductase flavoprotein 3; NADH-ubiquinone oxidoreductase flavoprotein 3, 10 kD; NDUFV3; Ndufv3l; renal carcinoma antigen NY-REN-4
Common Name NDUFV3
Gene Symbol NDUFV3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RVVSKGRGGLRKPEASHSFENRAPRVTVSAKEKTLLQKPHVDITDPEKPHQPKKKGSPAKPSEGRENARPKTTMPRSQVDEEFLKQSLKEKQLQKTFRLNEIDKESQKPFEVKGPLPVHTKSGLSA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.