missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30196375

Invitrogen™ Human NeuroD1 (aa 212-350) Control Fragment Recombinant Protein

Product Code. 30196375
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196375

Brand: Invitrogen™ RP100735

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82075 (PA5-82075. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NeuroD1 is a transcriptional activator that acts as a differentiation factor during neurogenesis. It has been demonstrated to bind to the insulin gene E-box. Efficient DNA binding requires dimerization with another basic helix-loop-helix (bHLH) protein. Defects in NEUROD1 are a cause of maturity onset diabetes of the young type VI (MODY6). MODY6 is a form of non-insulin-dependent diabetes mellitus characterized by an autosomal dominant mode of inheritance, onset during young adulthood and a primary defect in insulin secretion.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q13562
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4760
Name Human NeuroD1 (aa 212-350) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Basic helix-loop-helix factor 1; basic helix-loop-helix transcription factor; Beta2; beta-cell E-box transactivator 2; beta-cell E-box transcriptional activator 2; BHF1; BHF-1; bHLHa3; Class A basic helix-loop-helix protein 3; MODY6; neuro d1; Neurod; Neurod1; neurogenic differentiation 1; neurogenic differentiation factor 1; neurogenic helix-loop-helix protein NEUROD; neuronal differentiation 1
Common Name NeuroD1
Gene Symbol NEUROD1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFTMHYPAATLAGAQSHGSIFSGTAAPRCEIPIDNIMSFDSHSHHERVMSAQL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.