missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30206026

Invitrogen™ Human NME1 (aa 1-67) Control Fragment Recombinant Protein

Product Code. 30206026
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206026

Brand: Invitrogen™ RP89745

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NME1 was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in the gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P15531
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4830
Name Human NME1 (aa 1-67) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AL024257; AWD; expressed in non-metastatic cells 1; expressed in non-metastatic cells 1 protein; expressed in non-metastatic cells 1 protein (NM23A) (nucleoside diphosphate kinase); expressed in non-metastatic cells 1, protein; expressed in non-metastatic cells 1, protein (NM23A) (nucleoside diphosphate kinase); GAAD; Granzyme A activated DNase (GAAD); Granzyme A-activated DNase; GZMA activated DNase; included; metastasis inhibition factor NM23; NB; NBR-A; NBR-B; NBS; NDK A; NDK A 1; NDK A 2; NDK NBR-A; NDK NBR-B; NDKA; NDP kinase A; NDP kinase A 1; NDP kinase A 2; NDP kinase beta; NDP kinase NBR-A; NDPKA; NDPK-A; NM23; NM23A; NM23-C1; NM23-H1; NM23H1B; nm23-M1; NME/NM23 nucleoside diphosphate kinase 1; Nme1; NME1-1; NME1-NME2 spliced read-through transcript; non-metastatic cells 1, protein (NM23A) expressed in; nucleoside diphosphate kinase A; nucleoside diphosphate kinase A 1; nucleoside diphosphate kinase A 2; nucleoside diphosphate kinase NBR-B; nucleoside-diphosphate kinase 1; nucleoside-diphosphate kinase NBR-A; nucleotide diphosphate kinase; nucloside diphosphate kinase; tumor metastatic process-associated protein
Common Name NME1
Gene Symbol NME1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MVLLSTLGIVFQGEGPPISSCDTGTMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.