missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30199629

Invitrogen™ Human nNOS (aa 72-149) Control Fragment Recombinant Protein

Product Code. 30199629
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199629

Brand: Invitrogen™ RP106842

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NOS activity requires homodimerization as well as three cosubstrates (L-arginine, NADPH and O2) and five cofactors or prosthetic groups (FAD, FMN, calmodulin, tetrahydrobiopterin and heme). Several distinct NOS isoforms have been described and been shown to represent the products of three distinct genes. These include two constitutive Ca2+/CaM-dependent forms of NOS, including NOS1 (also designated ncNOS) whose activity was first identified in neurons, and NOS3 (also designated ecNOS), first identified in endothelial cells.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P29475
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4842
Name Human nNOS (aa 72-149) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310005C01Rik; bNOS; bNOS1; Brain NOS; Constitutive NOS; IHPS1; NC-NOS; neuronal nitric oxide synthase; neuronal nitric oxide synthase NOS1; neuronal NOS; nitric oxidase synthase; nitric oxide synthase; nitric oxide synthase 1; nitric oxide synthase 1 (neuronal); nitric oxide synthase 1, neuronal; nitric oxide synthase, brain; nNOS; N-NOS; nNOS; NOS type I; NO; NOS; NOS Type 1; NOS type I; Nos1; Nos-1; NOS-I; Peptidyl-cysteine S-nitrosylase NOS1; Phospho-bNOS; Phospho-Brain NOS
Common Name nNOS
Gene Symbol NOS1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGPPTKAVDLSHQPPAGKEQPLAV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.