missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Nogo-A (aa 689-823) Control Fragment Recombinant Protein

Product Code. 30203853
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203853

Brand: Invitrogen™ RP100974

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NogoA is a member of a family of integral membrane proteins termed reticulons that are thought to be involved in numerous disorders including neurodegenerative diseases. Reticulon proteins are known to regulate many cellular processes and interact with multiple proteins and receptors such as BACE. NogoA was initially identified as a myelin-associated neurite outgrowth inhibitor. It is highly expressed in oligodendrocytes in the white matter of the CNS, blocking its activity with antibodies or other factors results in improved axon regrowth and functional recovery in experimental CNS lesion models. NogoA has also been suggested to play a role in neurodegenerative diseases such as Amyotrophic lateral sclerosis, in which case NogoA is found at elevated levels in postmortem muscular samples, and multiple sclerosis (MS), in which case autoantibodies to NogoA have been found in serum and cerebrospinal fluid in MS patients.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NQC3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57142
Name Human Nogo-A (aa 689-823) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110020G17Rik; AA407876; AA409940; AA960376; ASY; C130026I10Rik; Foocen; glut4 vesicle 20 kDa protein; GLUT4 vesicle 20 kDa protein; Human NogoA; KIAA0886; mKIAA0886; mKIAA4153; My043; My043 protein; Nbla00271; Nbla10545; neurite growth inhibitor 220; neurite outgrowth inhibitor; Neuroendocrine-specific protein; Neuroendocrine-specific protein C homolog; NgA; NI220/250; NI-220/250; NI-250; Nogo; Nogo protein; Nogo-A; Nogo-B; NOGOC; Nogo-C; NSP; NSP-CL; r; rat N; rat NogoA; reticulon 4; reticulon 5; reticulon-4; Reticulon-5; RTN4; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C; RTN-x; SP1507; Vp20
Common Name Nogo-A
Gene Symbol Rtn4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ETEAPYISIACDLIKETKLSAEPAPDFSDYSEMAKVEQPVPDHSELVEDSSPDSEPVDLFSDDSIPDVPQKQDETVMLVKESLTETSFESMIEYENKEKLSALPPEGGKPYLESFKLSLDNTKDTLLPDEVSTLS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.