missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human NPRL2 (aa 312-379) Control Fragment Recombinant Protein

Product Code. 30197665
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30197665

Brand: Invitrogen™ RP96301

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58289 (PA5-58289. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NPRL2, also known as TUSC4 (tumor suppressor candidate 4), is a 380 amino acid protein that contains a bipartite nuclear localization signal and a granulin protein-binding domain. It is highly expressed in skeletal muscle, followed by brain, liver and pancreas, with lower expression in lung, kidney, placenta and heart. NPRL2 is also expressed in most lung cancer cell lines and may be involved in tumor suppression. NPRL2 may play a role in mismatch repair, cell cycle checkpoint signaling and activation of apoptotic pathways. It may also enhance the therapeutic efficacy of chemotherapy drugs such as cis-platin by resensitizing patients resistant to cisplatin treatment. The gene encoding NPRL2 is conserved between species and is expressed as two isoforms due to alternative splicing events.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8WTW4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10641
Name Human NPRL2 (aa 312-379) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2810446G01Rik; G21; G21 protein; GATOR complex protein NPRL2; Gene 21 protein; homologous to yeast nitrogen permease (candidate tumor suppressor); nitrogen permase homolog; nitrogen permease regulator 2-like protein; nitrogen permease regulator-like 2; nitrogen permease regulator-like 2 (S. cerevisiae); NPR 2 L; NPR L2; NPR like 2; NPR2; NPR2 like; NPR2L; NPR2-like protein; NPR2-like, GATOR1 complex subunit; NPRL 2; Nprl2; Tumor suppressor candidate 4; TUSC 4; TUSC 4 protein; TUSC4; TUSC4 protein
Common Name NPRL2
Gene Symbol NPRL2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KLIQFGLMKNLIRRLQKYPVRVTREEQSHPARLYTGCHSYDEICCKTGMSYHELDERLENDPNIIICW
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.