missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30206698

Invitrogen™ Human OFD1 (aa 337-425) Control Fragment Recombinant Protein

Product Code. 30206698
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206698

Brand: Invitrogen™ RP95177

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56642 (PA5-56642. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is located on the X chromosome and encodes a centrosomal protein. A knockout mouse model has been used to study the effect of mutations in this gene. The mouse gene is also located on the X chromosome, however, unlike the human gene it is not subject to X inactivation. Mutations in this gene are associated with oral-facial-digital syndrome type I and Simpson-Golabi-Behmel syndrome type 2. Many pseudogenes have been identified; a single pseudogene is found on chromosome 5 while as many as fifteen have been found on the Y chromosome.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O75665
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8481
Name Human OFD1 (aa 337-425) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 71-7 A; CXorf5; DXGgc7e; JBTS10; Ofd1; OFD1 centriole and centriolar satellite protein; ofd1 protein; OFD1, centriole and centriolar satellite protein; oral-facial-digital syndrome 1; oral-facial-digital syndrome 1 gene homolog; oral-facial-digital syndrome 1 gene homolog (human); oral-facial-digital syndrome 1 protein; Oral-facial-digital syndrome 1 protein homolog; ORF2; Protein 71-7 A; putative oral-facial-digital syndrome 1 protein; RGD1562231; RP23; SGBS2; wu:fa07a10; wu:fd17e11; zgc:92562
Common Name OFD1
Gene Symbol OFD1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SFEETYDRKLKNELLKYQLELKDDYIIRTNRLIEDERKNKEKAVHLQEELIAINSKKEELNQSVNRVKELELELESVKAQSLAITKQNH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.