missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human P-cadherin (aa 249-384) Control Fragment Recombinant Protein

Product Code. 30199911
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199911

Brand: Invitrogen™ RP100914

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110641 (PA5-110641. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

P-cadherin, also known as Cadherin-3, is a Type 1 cadherin protein that belongs to the cadherin superfamily. Type 1 cadherins are single-pass transmembrane proteins that have 5 extracellular cadherin repeats and an intracellular domain that binds p120-catenin and beta-catenin. Cadherins are calcium-dependent cell-cell adhesion glycoproteins responsible for a range of processes including development, wound healing, cell-cell signaling, cell growth and differentiation. P-cadherin is expressed in human fetal structures, and in adult tissues such as the basal layer of the epidermis, breast, prostate, ovary, cervix, hair follicle, and corneal endothelium. P-cadherin expression has also been reported on embryonic stem cells, and stem cells of the normal mammary gland, and hair follicle. Overexpression of P-cadherin has been associated with poor prognosis in breast, prostate, ovary, colon, and stomach carcinomas. Mutations in CDH3 are associated with congential hypotrichosis with juvenile macular dystrophy.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P22223
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1001
Name Human P-cadherin (aa 249-384) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI385538; CADH3; cadherin 15, M-cadherin (myotubule); cadherin 3; cadherin 3, type 1, P-cadherin (placental); cadherin-3; Cadp; calcium-dependent adhesion protein, placental; CDH3; CDHP; HJMD; PCAD; P-cadherin; Placental cadherin; Placental-cadherin; RPE-specific cadherin
Common Name P-cadherin
Gene Symbol Cdh3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILDANDNAPMFDPQKYEAHVPENAVGHEVQRLTVTDLDAPNSPAWRATYLIMGGDDGDHFTITTHPE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.