missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human P-cadherin (aa 249-384) Control Fragment Recombinant Protein

Product Code. 30199911
Click to view available options
Quantity:
100 μL
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30199911

Marque: Invitrogen™ RP100914

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110641 (PA5-110641. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

P-cadherin, also known as Cadherin-3, is a Type 1 cadherin protein that belongs to the cadherin superfamily. Type 1 cadherins are single-pass transmembrane proteins that have 5 extracellular cadherin repeats and an intracellular domain that binds p120-catenin and beta-catenin. Cadherins are calcium-dependent cell-cell adhesion glycoproteins responsible for a range of processes including development, wound healing, cell-cell signaling, cell growth and differentiation. P-cadherin is expressed in human fetal structures, and in adult tissues such as the basal layer of the epidermis, breast, prostate, ovary, cervix, hair follicle, and corneal endothelium. P-cadherin expression has also been reported on embryonic stem cells, and stem cells of the normal mammary gland, and hair follicle. Overexpression of P-cadherin has been associated with poor prognosis in breast, prostate, ovary, colon, and stomach carcinomas. Mutations in CDH3 are associated with congential hypotrichosis with juvenile macular dystrophy.
TRUSTED_SUSTAINABILITY

Spécification

Accession Number P22223
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1001
Name Human P-cadherin (aa 249-384) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI385538; CADH3; cadherin 15, M-cadherin (myotubule); cadherin 3; cadherin 3, type 1, P-cadherin (placental); cadherin-3; Cadp; calcium-dependent adhesion protein, placental; CDH3; CDHP; HJMD; PCAD; P-cadherin; Placental cadherin; Placental-cadherin; RPE-specific cadherin
Common Name P-cadherin
Gene Symbol Cdh3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILDANDNAPMFDPQKYEAHVPENAVGHEVQRLTVTDLDAPNSPAWRATYLIMGGDDGDHFTITTHPE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis