missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Pannexin 2 (aa 318-408) Control Fragment Recombinant Protein

Product Code. 30196469
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196469

Brand: Invitrogen™ RP95377

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Gap junctions are channel-forming structures that allow direct metabolic and electrical communication between adjacent cells of almost all types in mammalian tissues. In the human body, they are absent only in adult skeletal muscle cells and some circulating blood cells. A gap junction is formed two hemichannels, one in each of the neighboring cells, composed of six subunits. In mice and humans, at least 20 connexin and 3 pannexin genes encode gap junction proteins. Connexins are only found in chordates, while pannexins are present in both chordate and invertebrate genomes. Pannexins, previously known as innexins, are predicted to have four transmembrane regions, two extracellular loops, one intracellular loop, and intracellular N- and C-termini. Both human and mouse genomes contain three pannexin-encoded genes. Pannexin 2 (Px2, PANX2) appears to be a brain specific gene, and is abundantly expressed in the central nervous system, as is pannexin 1. In many neuronal cell populations, including hippocampus, olfactory bulb, cortex, and cerebellum, pannexin 1 and pannexin 2 are co-expressed; in other brain regions such as white matter, only pannexin 1-positive cells are found.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96RD6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 56666
Name Human Pannexin 2 (aa 318-408) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias h PX2; hPANX2; pannexin 2; pannexin-2; PANX2; Px2; si:ch211-192n14.2
Common Name Pannexin 2
Gene Symbol PANX2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SNFIFDKLHKVGIKTRRQWRRSQFCDINILAMFCNENRDHIKSLNRLDFITNESDLMYDNVVRQLLAALAQSNHDATPTVRDSGVQTVDPS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.