missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PCK1 (aa 14-146) Control Fragment Recombinant Protein

Product Code. 30202879
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202879

Brand: Invitrogen™ RP88964

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Phosphoenolpyruvate Carboxykinase 1 (PCK1) is a main control point for the regulation of gluconeogenesis. During gluconeogenesis PCK1 acts as the rate-limiting enzyme. PCK1 regulates the formation and maintenance of memory CH8(+) T-cells via gluconeogenesis. PCK1 aids in controlling the levels of metabolic intermediates in the citric acid cycle by regulating cataplerosis and anaplerosis. When glucose levels are high, PCK1 catalyzes the cataplerotic conversion of oxaloacetate to phosphoenolpyruvate (PEP). When they are low it catalyzes the anaplerotic conversion of phosphoenolpyruvate to oxaloacetate. When phosphorylated at Ser-90 by AKT1, PCK1 acts as a protein kinase by reducing the binding affinity to oxaloacetate and promotes an atypical serine protein kinase activity using GTP as the donor. This activity regulates lipogenesis by disrupting the interaction between INSIG proteins and SCAP and promoting nuclear translocation of SREBP proteins and transcription of lipogenesis-related genes. An important paralog of this gene is PCK2.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P35558
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5105
Name Human PCK1 (aa 14-146) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI265463; GTP; HGNC:8724; MGC22652; PCK; Pck1; Pck-1; PE PEPCKC; PEP carboxykinase; PEPCK; PEPCK1; PEPCKC; PEPCK-C; phosphoenolpyruvate carboxykinase (GTP); phosphoenolpyruvate carboxykinase 1; phosphoenolpyruvate carboxykinase 1 (soluble); phosphoenolpyruvate carboxykinase 1, cytosolic; phosphoenolpyruvate carboxykinase, cytosolic; phosphoenolpyruvate carboxykinase, cytosolic (GTP); phosphoenolpyruvate carboxykinase, cytosolic [GTP]; phosphoenolpyruvate carboxylase; phosphopyruvate carboxylase; RATPEPCK
Common Name PCK1
Gene Symbol PCK1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KVVQGSLDSLPQAVREFLENNAELCQPDHIHICDGSEEENGRLLGQMEEEGILRRLKKYDNCWLALTDPRDVARIESKTVIVTQEQRDTVPIPKTGLSQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.