missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PCNA (aa 80-163) Control Fragment Recombinant Protein

Product Code. 30196280
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196280

Brand: Invitrogen™ RP95287

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111000 (PA5-111000. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PCNA (polymerase delta auxiliary protein) is essential for DNA replication and is involved in DNA excision and mismatch repair pathways. PCNA binds to the CDK inhibitor p21, the structure-specific endonucleases Fen1 and XPG, and DNA cytosine 5-methyltransferase (MCMT). PCNA is a potentially useful marker of cells with proliferative potential and for identifying the proliferation status of tumor tissue (i.e. relevant to prognosis). PCNA is a marker for cells in early G1 phase and S phase of the cell cycle. PCNA is found in the nucleus and is a cofactor of DNA polymerase delta, and acts as a homotrimer and helps increase the processing of leading strand synthesis during DNA replication. In response to DNA damage, PCNA is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for PCNA. Pseudogenes of PCNA have been described on chromosome 4 and on the X chromosome.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P12004
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5111
Name Human PCNA (aa 80-163) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ATLD2; cb16; Cyclin; DNA polymerase delta auxiliary protein; etID36690.10; fa28e03; fb36g03; HGCN8729; hypothetical protein LOC515499; MGC8367; Pcna; pcna protein; Pcna/cyclin; PCNAR; POL30; Proliferating cell nuclear antigen; wu:fa28e03; wu:fb36g03; YBR0811; YBR088C
Common Name PCNA
Gene Symbol Pcna
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.