missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30197872

Invitrogen™ Human PCTAIRE1 (aa 1-123) Control Fragment Recombinant Protein

Product Code. 30197872
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30197872

Brand: Invitrogen™ RP91929

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-110621 (PA5-110621, PA5-81933 (PA5-81933. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CDK16 (PCTK1)/cyclin Y belongs to the cdc2/cdkx subfamily of the ser/thr family of protein kinases. CDK16 plays a role in signal transduction cascades in terminally differentiated cells, in exocytosis, and in transport of secretory cargo from the endoplasmic reticulum. CDK16 is ubiquitously expressed with the highest levels detected in the brain and testis. CDK16 also contained the gene coding for ubiquitin-activating enzyme UBE1 that previously shown to mapped to Xp11.3.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q00536
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5127
Name Human PCTAIRE1 (aa 1-123) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Cdk16; cdk16.L; cdk16.S; Cell division protein kinase 16; Crk5; cyclin dependent kinase 16; cyclin-dependent kinase 16; cyclin-dependent kinase 16 L homeolog; cyclin-dependent kinase 16 S homeolog; FLJ16665; PCTAIRE; PCTAIRE protein kinase 1; PCTAIRE1; PCTAIRE-1 protein kinase, alternatively spliced; PCTAIRE-motif protein kinase 1; pctgaire; pctk1; PCTK1 protein; Serine/threonine-protein kinase PCTAIRE-1; testis secretory sperm-binding protein Li 224 n
Common Name PCTAIRE1
Gene Symbol CDK16
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MDRMKKIKRQLSMTLRGGRGIDKTNGAPEQIGLDESGGGGGSDPGEAPTRAAPGELRSARGPLSSAPEIVHEDLKMGSDGESDQASATSSDEVQSPVRVRMRNHPPRKISTEDINKRLSLPAD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.