missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30207147

Invitrogen™ Human PERP (aa 36-73) Control Fragment Recombinant Protein

Product Code. 30207147
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207147

Brand: Invitrogen™ RP88749

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110879 (PA5-110879. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The p53 tumor-suppressor gene integrates numerous signals that control cell life and death. Several novel molecules involved in p53 network, including Chk2, p53R2, p53AIP1, Noxa, PIDD, PID/MTA2, MTBP and PERP, were identified and their genes were cloned recently. PERP, also termed PIGPC1 and THW, is a plasma membrane protein. p53 binds to the promoter of PERP and transcriptionally activates PERP gene then the translated PERP protein mediates the p53 induced apoptosis. The expression of PERP causes cell death. PERP is a mediator of p53 induced apoptosis. PERP has sequence similarity to PMP-22/gas3 and is a new member of the PMP-22/gas3 family.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96FX8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 64065
Name Human PERP (aa 36-73) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110017A08Rik; dJ496H19.1; HGNC:17637; KCP1; KCP-1; keratinocyte associated protein 1; keratinocyte-associated protein 1; keratinocytes associated protein 1; KRTCAP1; p53 apoptosis effector related to PMP22; p53 apoptosis effector related to PMP-22; p53 apoptosis-associated target; p53-induced protein PIGPC1; PERP; PERP, TP53 apoptosis effector; PIGPC1; RP3-496H19.1; THW; Transmembrane protein THW
Common Name PERP
Gene Symbol PERP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAW
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.