missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30204151

Invitrogen™ Human PEX2 (aa 7-137) Control Fragment Recombinant Protein

Product Code. 30204151
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204151

Brand: Invitrogen™ RP90398

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52832 (PA5-52832. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes an integral peroxisomal membrane protein required for peroxisome biogenesis. The protein is thought to be involved in peroxisomal matrix protein import. Mutations in this gene result in one form of Zellweger syndrome and infantile Refsum disease. Alternative splicing results in multiple transcript variants encoding the same protein.

Specifications

Accession Number P28328
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5828
Name Human PEX2 (aa 7-137) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 35 kDa peroxisomal membrane protein; D3Ertd138e; Paf1; PAF-1; PBD5A; PBD5B; peroxin 2; Peroxin-2; peroxisomal biogenesis factor 2; Peroxisomal membrane protein 3; peroxisomal membrane protein 3, 35 kDa; peroxisomal membrane protein 3, 35 kDa; peroxisome assembly factor 1; peroxisome assembly factor-1; peroxisome biogenesis factor 2; Pe x 2; PMP3; Pmp35; Pxmp3; RING finger protein 72; RNF72; Zellweger syndrome homolog; ZWS3
Common Name PEX2
Gene Symbol PEX2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NAKSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVKACLWVFLWRFTIYSKNATVGQSVLNIKYKNDFSPNLRYQPPSKNQKIWYAVCTIGGRWLEERCYDLFRNHHLASFGKVKQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.