missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30207017

Invitrogen™ Human PIK3C2A (aa 804-892) Control Fragment Recombinant Protein

Product Code. 30207017
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207017

Brand: Invitrogen™ RP97269

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Class II PI3 kinases, including PIK3C2A, phosphorylate the 3 position of PI or PI4P. Though not as well studied as the Class I PI3 kinases, the Class II enyzmes have been linked to diverse, receptor-mediated cellular processes including insulin signaling, neuronal survival, and growth factor signaling. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain as well as a C-terminal C2 domain, a characteristic of class II PI3-kinases. C2 domains act as calcium-dependent phospholipid binding motifs that mediate translocation of proteins to membranes, and may also mediate protein-protein interactions. The PI3-kinase activity of this protein is not sensitive to nanomolar levels of the inhibitor wortmanin. This protein was shown to be able to be activated by insulin and may be involved in integrin-dependent signaling.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O00443
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5286
Name Human PIK3C2A (aa 804-892) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C2-containing phosphatidylinositol kinase; CPK; Cpk-m; DKFZp686L193; MGC142218; p170; phosphatidylinositol 3-kinase, C2 domain containing, alpha polypeptide; phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha; phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit alpha; phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 alpha; phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 alpha; phosphoinositide 3-kinase-C2-alpha; phosphoinositide-3-kinase, class 2, alpha polypeptide; PI3KC2; PI3-K-C2(ALPHA); pi3kc2a; PI3-K-C2A; PI3K-C2alpha; PI3K-C2-alpha; Pik3c2a; ptdIns-3-kinase C2 subunit alpha
Common Name PIK3C2A
Gene Symbol PIK3C2A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence CGTKLLYLWTSSHTNSVPGTVTKKGYVMERIVLQVDFPSPAFDIIYTTPQVDRSIIQQHNLETLENDIKGKLLDILHKDSSLGLSKEDK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.