missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200073

Invitrogen™ Human PIK3C2G (aa 9-100) Control Fragment Recombinant Protein

Product Code. 30200073
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200073

Brand: Invitrogen™ RP109746

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (47%), Rat (47%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145167 (PA5-145167. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PIK3C2G lipid kinase belongs to the phosphoinositide 3-kinase (PI3K) family which play major roles in signaling pathways and are involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. PIK3C2G contains a lipid kinase catalytic domain as well as a C-terminal C2 domain, a characteristic of class II PI3-kinases that act as calcium-dependent phospholipid binding motifs which mediate translocation of proteins to membranes, and may also mediate protein-protein interactions. The N-terminal region of PIK3C2G and the C-terminal C2 domain are required for enzymatic activity. The PI 3-kinase C2gamma gene encodes a 1,050 amino acid polypeptide with 36% identity to human PI 3-kinase C2alpha. Research indicates that PI 3-kinase C2gamma can block the growth of human colon cancer cells.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O75747
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5288
Name Human PIK3C2G (aa 9-100) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C80387; phosphatidylinositol 3-kinase, C2 domain containing, gamma polypeptide; phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma; phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing gamma polypeptide; phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit gamma; phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 gamma; phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 gamma; phosphoinositide 3-Kinase-C2-gamma; phosphoinositide-3-kinase, class 2, gamma polypeptide; PI 3-kinase C2gamma; PI3KC2gamma; PI3K-C2gamma; PI3K-C2-gamma; Pik3c2g; PTDINS-3-kinase C2 gamma; ptdIns-3-kinase C2 subunit gamma
Common Name PIK3C2G
Gene Symbol PIK3C2G
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PNPNESHEKQYEHQEFLFVNQPHSSSQVSLGFDQIVDEISGKIPHYESEIDENTFFVPTAPKWDSTGHSLNEAHQISLNEFTSKSRELSWHQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.