missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30204437

Invitrogen™ Human PIN1 (aa 104-163) Control Fragment Recombinant Protein

Product Code. 30204437
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204437

Brand: Invitrogen™ RP105456

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PIN1 (Peptidylprolyl Cis/Trans Isomerase, NIMA-Interacting 1) is a Protein Coding gene. Diseases associated with PIN1 include Meibomian Cyst and Viral Exanthem. Among its related pathways are Transport of the SLBP independent Mature mRNA and Cytokine Signaling in Immune system. Gene Ontology (GO) annotations related to this gene include peptidyl-prolyl cis-trans isomerase activity and mitogen-activated protein kinase binding.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q13526
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5300
Name Human PIN1 (aa 104-163) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0610025L01Rik; D9Bwg1161e; DOD; EC 5.2.1.8; NIMA-interacting; peptidylprolyl cis/trans isomerase, NIMA-interacting 1; peptidylprolyl cis/trans isomerase, NIMA-interacting 1 A; peptidylprolyl cis/trans isomerase, NIMA-interacting 1 S homeolog; Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1; peptidyl-prolyl cis-trans isomerase Pin1; pin1; pin1.S; pin1a; pin1-a; pin1-b; PPIase Pin1; prolyl isomerase; prolyl isomerase Pin1; protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting 1; protein (peptidylprolyl cis/trans isomerase) NIMA-interacting 1; rotamase Pin1; ubl5; XELAEV_18021616mg
Common Name PIN1
Gene Symbol Pin1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.