missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30202104

Invitrogen™ Human Plasminogen (aa 251-312) Control Fragment Recombinant Protein

Product Code. 30202104
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202104

Brand: Invitrogen™ RP92037

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Plasminogen is a plasma protein synthesized mostly in the liver. It consists of a single polypeptide chain and has a molecular weight of 88.5 kDa. The plasma concentration is usually in the range of 70 - 200 mg/L. Plasminogen is activated by tissue-plasminogen activator, urokinase and streptokinase, to form plasmin. Activation results from the cleavage and release of the preactivation peptide. Plasmin consists of a heavy (A-) chain which contains 5 kringles and a light (B-) chain with the active site. Plasmin is a trypsin-like protease whose natural substrate is fibrin, with binding sites for fibrin residing on the kringles. Plasmin is essential for fibrinolysis and decreased fibrinolytic potential due to congenital defects in plasmin can lead to recurring thrombosis, thrombophlebitis and pulmonary embolism.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P00747
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5340
Name Human Plasminogen (aa 251-312) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Ab1-346; Activation peptide; AI649309; angiostatin; DKFZp779M0222; Pg; plasmin; plasmin heavy chain A; Plasmin heavy chain A, short form; Plasmin light chain B; plasminogen; PLG; RP1-81D8.1
Common Name Plasminogen
Gene Symbol PLG
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.