missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30206699

Invitrogen™ Human PLEKHA6 (aa 867-948) Control Fragment Recombinant Protein

Code produit. 30206699
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μL
missing translation for 'unitSize'
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30206699

missing translation for 'mfr': Invitrogen™ RP94312

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55778 (PA5-55778. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PLEKHA6 (Pleckstrin Homology Domain Containing A6) is a Protein Coding gene. Among its related pathways arePI MetabolismandGlycerophospholipid biosynthesis.
TRUSTED_SUSTAINABILITY

Spécification

Accession Number Q9Y2H5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 22874
Name Human PLEKHA6 (aa 867-948) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9530028L01Rik; AU042621; KIAA0969; LOW QUALITY PROTEIN: pleckstrin homology domain-containing family A member 6; PEPP3; PEPP-3; PH domain-containing family A member 6; phosphoinositol 3-phosphate-binding protein 3; phosphoinositol 3-phosphate-binding protein-3; pleckstrin homology domain containing A6; pleckstrin homology domain containing, family A member 6; pleckstrin homology domain-containing family A member 6; pleckstrin homology domain-containing family A member 6; LOW QUALITY PROTEIN: pleckstrin homology domain-containing family A member 6; Plekha6; RGD1564395
Common Name PLEKHA6
Gene Symbol PLEKHA6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SIHEVDISNLEAALRAEEPGGHAYETPREEIARLRKMELEPQHYDVDINKELSTPDKVLIPERYIDLEPDTPLSPEELKEKQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis