missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PMCA3 ATPase (aa 1115-1219) Control Fragment Recombinant Protein

Product Code. 30212276
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212276

Brand: Invitrogen™ RP92112

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis. The mammalian plasma membrane calcium ATPase isoforms are encoded by at least four separate genes and the diversity of these enzymes is further increased by alternative splicing of transcripts. The expression of different isoforms and splice variants is regulated in a developmental, tissue- and cell type-specific manner, suggesting that these pumps are functionally adapted to the physiological needs of particular cells and tissues. This gene encodes the plasma membrane calcium ATPase isoform 3. Alternatively spliced transcript variants encoding different isoforms have been identified.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q16720
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 492
Name Human PMCA3 ATPase (aa 1115-1219) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6430519O13Rik; ATP2B3; ATPase plasma membrane Ca2+ transporting 3; ATPase, Ca++ transporting, plasma membrane 3; CFAP39; cilia and flagella associated protein 39; CLA2; LOW QUALITY PROTEIN: plasma membrane calcium-transporting ATPase 3; OPCA; plasma membrane calcium ATPase; Plasma membrane calcium ATPase isoform 3; plasma membrane calcium pump; Plasma membrane calcium pump isoform 3; Plasma membrane calcium-transporting ATPase 3; PMCA3; PMCA3a; SCAX1
Common Name PMCA3 ATPase
Gene Symbol ATP2B3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IRVVKAFRSSLYEGLEKPESKTSIHNFMATPEFLINDYTHNIPLIDDTDVDENEERLRAPPPPSPNQNNNAIDSGIYLTTHVTKSATSSVFSSSPGSPLHSVETS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.