missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PNPase (aa 647-741) Control Fragment Recombinant Protein

Product Code. 30202767
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202767

Brand: Invitrogen™ RP96093

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83236 (PA5-83236. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PNPT1 (polyribonucleotide nucleotidyltransferase 1, mitochondirla) is a RNA-binding protein implicated in numerous RNA metabolic processes. It catalyzes the phosphorolysis of single-stranded polyribonucleotides processively in the 3'-to-5' direction. PNPT1 is a component of the mitochondrial degradosome (mtEXO) complex that degrades 3' overhang double-stranded RNA with a 3'-to-5' directionality in an ATP-dependent manner. It is required for correct processing and polyadenylation of mitochondrial mRNAs. It plays a role as a cytoplasmic RNA import factor, in mitochondrial morphogenesis and respiration, regulation of expression of the electron transport chain, regulation of the stability of specific mature miRNAs in melanoma cells, and RNA cell surveilance. Mutations of the gene can result in combined oxidative phosphorylation deficiency 13 (COXPD13) and deafness, autosomal recessive, 70 (DFNB70).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8TCS8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 87178
Name Human PNPase (aa 647-741) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1200003F12Rik; 3'-5' RNA exonuclease OLD35; COXPD13; DFNB70; DKFZp762K1914; old 35; Old35; old-35; PNPase; PNPase 1; PNPase old-35; Pnpt1; Pnptl1; polynucleotide phosphorylase 1; Polynucleotide phosphorylase-like protein; polyribonucleotide nucleotidyltransferase 1; polyribonucleotide nucleotidyltransferase 1, mitochondrial
Common Name PNPase
Gene Symbol PNPT1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FSVFAPTPSAMHEARDFITEICKDDQEQQLEFGAVYTATITEIRDTGVMVKLYPNMTAVLLHNTQLDQRKIKHPTALGLEVGQEIQVKYFGRDPA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.