missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30206382

Invitrogen™ Human PP11 (aa 20-111) Control Fragment Recombinant Protein

Codice prodotto. 30206382
Click to view available options
Quantity:
100 μL
Dimensione della confezione:
100µL
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Codice prodotto. 30206382

Marca: Invitrogen™ RP105427

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66924 (PA5-66924. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein with protease activity and is expressed in the placenta. The protein may be useful as a tumor marker. Multiple alternatively spliced transcript variants have been found for this protein.
TRUSTED_SUSTAINABILITY

Specifica

Accession Number P21128
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8909
Name Human PP11 (aa 20-111) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 22 serine protease; 26 serine protease; endonuclease, poly(U) specific; endonuclease, poly(U)-specific; endonuclease, polyU-specific; ENDOU; P11; placental protein 11; placental protein 11 related; placental protein 11-related protein; Poly(U)-specific endoribonuclease; PP11; Pp11r; PP11-related protein; Protein endoU; PRSS26; T-cell-specific protein 30; Tcl-30; Uridylate-specific endoribonuclease
Common Name PP11
Gene Symbol ENDOU
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KIESCASRCNEKFNRDAACQCDRRCLWHGNCCEDYEHLCTEDHKESEPLPQLEEETEEALASNLYSAPTSCQGRCYEAFDKHHQCHCNARCQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Vedi altri risultati Mostra meno risultati
Correzione del contenuto del prodotto

Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.

Titolo del prodotto

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.

Grazie per averci aiutato a migliorare il nostro sito web. Il vostro feedback è stato inviato