missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200907

Invitrogen™ Human PRDX1 (aa 35-159) Control Fragment Recombinant Protein

Product Code. 30200907
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200907

Brand: Invitrogen™ RP88753

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. Three transcript variants encoding the same protein have been identified for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q06830
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5052
Name Human PRDX1 (aa 35-159) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ACR1; Alu co-repressor 1; AOEB166; B166; HBP23; heme-binding 23 kDa protein; macrophage 23 Kd stress protein; macrophage 23 kDa stress protein; macrophage 23 kDa stress protein; macrophase stress protein 22 kDa; macrophase stress protein 23 kd; Msp23; Natural killer cell-enhancing factor A; natural killer-enhancing factor A; NkefA; NKEF-A; OSF3; OSF-3; osteoblast specific factor 3; osteoblast-specific factor 3; PAG; Paga; PAGB; peroxiredoxin 1; peroxiredoxin-1; PRD x 1; PrdxI; proliferation-associated gene A; proliferation-associated gene protein; Prx; Prx 1; PR x 1; PRXI; TDP x 2; TD x 2; thioredoxin dependent peroxide reductase 2; thioredoxin peroxidase 2; Thioredoxin-dependent peroxide reductase 2; TPxA; Trx dependent peroxide reductase 2
Common Name PRDX1
Gene Symbol PRDX1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.