missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PRDX5 Control Fragment Recombinant Protein

Product Code. 30208067
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30208067

Brand: Invitrogen™ RP102791

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (43%), Rat (43%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83396 (PA5-83396. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Peroxiredoxin (Prx) is a growing peroxidase family, whose mammalian members have been known to connect with cell proliferation, differentiation, and apoptosis. Many isoforms (about 50 proteins), collected in accordance to the amino acid sequence homology, containing active site cysteine residue, and the thiol-specific antioxidant activity, distribute throughout all the kingdoms. Among them, mammalian Prx consists of 6 different members grouped into typical 2-Cys, atypical 2-Cys Prx, and 1-Cys Prx. Except Prx VI belonging to 1-Cys Prx subgroup, the other five 2-Cys Prx isotypes have the thioredoxin-dependent peroxidase (TPx) activity utilizing thioredoxin, thioredoxin reductase, and NADPH as a reducing system. Mammalian Prxs are 20-30 kilodalton in molecular size and vary in subcellular localization: Prx I, II, and VI in cytosol, Prx III in mitochondria, Prx IV in ER and secretion, Prx V showing complicated distribution including peroxisome, mitochondria and cytosol.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P30044
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 25824
Name Human PRDX5 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ACR1; Alu corepressor 1; Alu co-repressor 1; Antioxidant enzyme B166; AOEB166; AOPP; B166; epididymis secretory protein Li 55; HEL-S-55; Liver tissue 2 D-page spot 2 D-0014 IV; liver tissue 2 D-page spot 71 B; peroxiredoxin 5; peroxiredoxin 6; peroxiredoxin V; Peroxiredoxin-5, mitochondrial; peroxisomal antioxidant enzyme; peroxisomal membrane protein 20; PLP; Pmp20; PRD x 5; Prd x 6; Pr x 5; PrxV; prx-V; SBBI10; Thioredoxin peroxidase PMP20; thioredoxin reductase; TPx type VI
Common Name PRDX5
Gene Symbol PRDX5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MGLAGVCALRRSAGYILVGGAGGQSAAAAARRCSEGEWASGGVRSFSRAAAAMAPIKVGDAIPAVEVFEGEPGN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.