missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30209069

Invitrogen™ Human PSA (aa 93-235) Control Fragment Recombinant Protein

Product Code. 30209069
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209069

Brand: Invitrogen™ RP96657

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PSA is a chymotrypsin-like serine protease (kallikrein family) produced by the prostate epithelium, and is abundant in seminal fluid. PSA can be detected in the sera of patients with prostatic carcinoma. It is predominantly complexed to a liver-derived serine protease inhibitor, alpha-1-antichymotrypsin (ACT). A higher proportion of serum PSA is complexed to ACT in prostate cancer than in benign prostate hyperplasia. PSA is used to confirm prostatic acinar cell origin in primary and metastatic carcinoma and to rule out non-prostatic carcinoma mimics.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P07288
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 354
Name Human PSA (aa 93-235) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Antigen; antigen, prostate specific; APS; Fletcher factor; gamma-seminoprotein; hK3; Kal3; Kal-3; Kallikrein 3; kallikrein 3, plasma; kallikrein B, plasma 1; kallikrein related peptidase 3; kallikrein-3; Kallikrein-3 (KLK3); kallikrein-related peptidase 3; Kalp1; KALP15; Kininogenin; KLK2A1; Klk3; KLK-3; Klkb1; P-30 antigen; Pk.; Plasma kallikrein; Plasma kallikrein heavy chain; Plasma kallikrein light chain; Plasma prekallikrein; prostate specific antigen; prostate-specific (APS); prostate-specific antigen; PSA; Semenogelase; seminin
Common Name PSA
Gene Symbol KLK3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.