missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30195476

Invitrogen™ Human PSMB5 (aa 3-61) Control Fragment Recombinant Protein

Product Code. 30195476
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30195476 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30195476 Supplier Invitrogen™ Supplier No. RP105209

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cyclic nucleotide phosphodiesterases.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P28074
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5693
Name Human PSMB5 (aa 3-61) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias LMPX; Macropain epsilon chain; MB1; MGC118075; Multicatalytic endopeptidase complex epsilon chain; proteasome (prosome, macropain) subunit, beta type 5; proteasome (prosome, macropain) subunit, beta type, 5; proteasome 20 S subunit beta 5; proteasome beta 5 subunit; proteasome beta type subunit 5; proteasome catalytic subunit 3; proteasome chain 6; Proteasome epsilon chain; proteasome subunit beta 5; proteasome subunit beta type-5; Proteasome subunit MB1; proteasome subunit X; proteasome subunit, beta type, 5; PSMB5; PSX large multifunctional protease X; testicular tissue protein Li 153; Unknown (protein for MGC:134464); X
Common Name PSMB5
Gene Symbol PSMB5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGTT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.