missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PTGDS (aa 155-190) Control Fragment Recombinant Protein

Product Code. 30204716
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204716

Brand: Invitrogen™ RP109818

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a glutathione-independent prostaglandin D synthase that catalyzes the conversion of prostaglandin H2 (PGH2) to postaglandin D2 (PGD2). PGD2 functions as a neuromodulator as well as a trophic factor in the central nervous system. PGD2 is also involved in smooth muscle contraction/relaxation and is a potent inhibitor of platelet aggregation. PTGDS has also been implicated in the development and maintenance of the blood-brain, blood-retina, blood-aqueous humor and blood-testis barrier. Studies with transgenic mice overexpressing this gene suggest that this gene may be also involved in the regulation of non-rapid eye movement (NREM) sleep. It is likely to play important roles in both maturation and maintenance of the central nervous system and male reproductive system. PTGDS is the most abundant protein in the cerebral spinal fluid and recent evidence suggests that PTGDS acts as a Beta-Amyloid chaperone and may have a role in the deposition of Ab plaques in Alzheimer's disease.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P41222
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5730
Name Human PTGDS (aa 155-190) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 21 kDa; Beta-trace protein; cerebrin-28; Glutathione-independent PGD synthase; glutathione-independent PGD synthetase; lipocalin-type prostaglandin D synthase; lipocalin-type prostaglandin-D synthase; LPGDS; L-PGDS; PDS; PGD2; PGD2 synthase; PGDS; PGDS2; PH2DISO; Prostaglandin D synthase; prostaglandin D2 synthase; prostaglandin D2 synthase (21 kDa, brain); prostaglandin D2 synthase (brain); prostaglandin D2 synthase 21 kDa (brain); prostaglandin-D2 synthase; Prostaglandin-H2 D-isomerase; Ptgds; Ptgs3; testis tissue sperm-binding protein Li 63 n
Common Name PGD2
Gene Symbol PTGDS
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PRAELKEKFTAFCKAQGFTEDTIVFLPQTDKCMTEQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.