missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30205682

Invitrogen™ Human RASA1 (aa 948-1035) Control Fragment Recombinant Protein

Product Code. 30205682
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205682

Brand: Invitrogen™ RP107344

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84651 (PA5-84651. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TACC1 is located on 8p11 chromosomal region that is amplified in approximately 15% of all breast tumor samples. The short arm of chromosome 8 also contains FGFR1 whose expression is enhanced in most breast cancer tumors. TACC family members, TACC1, TACC2, and TACC3, map very closely to the corresponding FGFR1, FGFR2, FGFR3 genes on chromosomes 4,8, and 10. Subsequently, since they are phylogenetically related, it is proposed that TACC and FGFR have similar roles in cell growth and differentiation. Also, TACC1 contains a conserved C-terminal region as in the Drosophila homolog, D-TACC. It has been shown that D-TACC is necessary for normal spindle function, and the mammalian TACC proteins appears to interact with centrosomes and microtubules in a similar manner.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P20936
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5921
Name Human RASA1 (aa 948-1035) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CMAVM; CM-AVM; Gap; GAPX; GTPase-activating protein; p120; p120 RAS GTPase activating protein; p120GAP; p120RASGAP; p120-rasGAP; PKWS; Ras GTPase-activating protein 1; ras GTPase-activating protein 1-like protein; Ras p21 protein activator; RAS p21 protein activator (GTPase activating protein RAS p21); RAS p21 protein activator (GTPase activating protein) 1; RAS p21 protein activator 1; Rasa; RASA1; RASGAP; triphosphatase-activating protein; unnamed protein product
Common Name RASA1
Gene Symbol RASA1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AKEPYMEGVNPFIKSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLLAITELLQQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.