missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30202936

Invitrogen™ Human RBBP6 (aa 1295-1383) Control Fragment Recombinant Protein

Product Code. 30202936
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202936

Brand: Invitrogen™ RP106045

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111180 (PA5-111180. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a cilia-associated protein belonging to the kinesin family. This protein plays a role in the sonic hedgehog (SHH) signaling pathway through the regulation of GLI transcription factors. It functions as a negative regulator of the SHH pathway by preventing inappropriate activation of GLI2 in the absence of ligand, and as a positive regulator by preventing the processing of GLI3 into its repressor form. Mutations in this gene have been associated with various ciliopathies.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q7Z6E9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5930
Name Human RBBP6 (aa 1295-1383) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4933422O15Rik; AI316869; BB233631; C030034J04Rik; C77662; E3 ubiquitin-protein ligase RBBP6; im:7158869; MY038; my038-like; P2PR; P2P-R; p53-associated cellular protein of testis; PACT; Proliferation potential-related protein; protein P2P-R; RB binding protein 6, ubiquitin ligase; RB-binding Q-protein 1; Rbbp6; rbbp6l; RBQ1; RBQ-1; retinoblastoma binding protein 6; retinoblastoma-binding protein 6; retinoblastoma-binding protein 6, isoform 3; retinoblastoma-binding Q protein 1; RING-type E3 ubiquitin transferase RBBP6; SNAMA
Common Name RBBP6
Gene Symbol Rbbp6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TMEEYNNDNTAPAEDVIIMIQVPQSKWDKDDFESEEEDVKSTQPISSVGKPASVIKNVSTKPSNIVKYPEKESEPSEKIQKFTKDVSHE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.