missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RFC1 (aa 717-804) Control Fragment Recombinant Protein

Product Code. 30198494
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198494

Brand: Invitrogen™ RP105469

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Replication factor C (RFC) is an essential DNA polymerase accessory protein that is required for numerous aspects of DNA metabolism, including DNA replication, DNA repair and telomere metabolism. RFC is a heteropentameric complex that recognizes a primer on a template DNA, binds to a primer terminus and loads proliferating cell nuclear antigen (PCNA) onto DNA at primer-template junctions in an ATP-dependent reaction. All five of the RFC subunits share a set of related sequences (RFC boxes) that include nucleotide binding consensus sequences. Four of the five RFC genes (RFC1, RFC2, RFC3 and RFC4) have consensus ATP-binding motifs. The small RFC proteins, RFC2, RFC3, RFC4 and RFC5, interact with Rad24, whereas the RFC1 subunit does not. RFC2, the third-largest subunit of the RFC complex, exhibits ATP binding which makes it important for both DNA replication and checkpoint function.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P35251
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5981
Name Human RFC1 (aa 717-804) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 140 kDa; A1; A1 140 kDa subunit; A1-P145; Activator 1 140 kDa subunit; activator 1 large subunit; Activator 1 subunit 1; Alp145; Differentiation-specific element-binding protein; DNA-binding protein PO-GA; Ibf-1; ISRE-binding protein; MHC binding factor, beta; MHCBFB; PO-GA; RECC1; replication factor C (activator 1) 1; replication factor C (activator 1) 1, 145 kDa; replication factor C 1; replication factor C 140 kDa subunit; Replication factor C large subunit; replication factor C subunit 1; Replication factor C subunit 1-like protein; replication factor C, 140 kDa; replication factor C1; RFC; RF-C 140 kDa subunit; Rfc1; RFC140
Common Name RFC1
Gene Symbol RFC1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LIMDEVDGMAGNEDRGGIQELIGLIKHTKIPIICMCNDRNHPKIRSLVHYCFDLRFQRPRVEQIKGAMMSIAFKEGLKIPPPAMNEII
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.