missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30196114

Invitrogen™ Human RGP1 (aa 1-96) Control Fragment Recombinant Protein

Product Code. 30196114
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196114

Brand: Invitrogen™ RP92905

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54201 (PA5-54201. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Retrograde golgi transport homolog 1 (RGP1) is the mammalian homolog to the yeast RGP1, a protein that forms a tight complex with RIC1. This complex binds Ypt6p and stimulates guanine nucleotide exchange. RGP1 is localized to the Golgi and is thought to be a potential Golgi recycling factor. Rgp1 yeast mutants exhibit defects in retrograde trafficking similar to those seen in yeast with mutations in other retrograde Golgi transport proteins. It is expected that RGP1 plays a similar role in mammalian cells to that seen in yeast.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q92546
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9827
Name Human RGP1 (aa 1-96) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110029E03Rik; AI527196; F730001J03; KIAA0258; mKIAA0258; RAB6A-GEF complex partner protein 2; Retrograde Golgi transport protein RGP1 homolog; RGD1311757; RGP1; RGP1 (HGNC:21965); RGP1 homolog, RAB6A GEF complex partner 1; RGP1 retrograde golgi transport homolog; RGP1 retrograde golgi transport homolog (S. cerevisiae)
Common Name RGP1
Gene Symbol RGP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MIEVVAELSRGPVFLAGEALECVVTVTNPLPPTATSASSEALAWASAQIHCQFHASESRVALPPPDSSQPDVQPDSQTVFLPHRGERGQCILSTPP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.