missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RhoG (aa 117-155) Control Fragment Recombinant Protein

Product Code. 30199049
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199049

Brand: Invitrogen™ RP97508

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58958 (PA5-58958. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Ras p21 family of guanine nucleotide proteins has been widely studied in view of its apparent role in signal transduction pathways and high frequency of mutations in human malignancies. It is now clear, however, that the Ras proteins (H-, K- and N-Ras p21) are members of a much larger superfamily of related proteins. Six members of this family, Rap 1A, Rap 1B, Rap 2, R-Ras, Ral A and Ral B, exhibit approximately 50% amino acid homology to Ras. The six mammalian Rho proteins (Rho A, B, C, G, 7 and 8) are approximately 30% homologous to Ras and are expressed in a wide range of cell types. Both Ras p21 and Rho p21, as well as other members of the Ras superfamily, contain a carboxy-terminal CAAX sequence (C, cysteine; A, aliphatic amino acid; X, any amino acid) which in the case of Ras has been shown to be essential for correct localization and function.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P84095
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 391
Name Human RhoG (aa 117-155) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2810426G09Rik; aplysia ras-related homolog G (RhoG); Arhg; ras homolog family member G; ras homolog G (RhoG); ras homolog gene family, member G; ras homolog gene family, member G (rho G); Rho G; Rhog; rho-related GTP-binding protein RhoG; Sid 10750; Sid10750
Common Name RhoG
Gene Symbol RHOG
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.