missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RhoGAP (aa 304-431) Control Fragment Recombinant Protein

Product Code. 30196556
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30196556 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30196556 Supplier Invitrogen™ Supplier No. RP102446

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82344 (PA5-82344. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The p190 RhoGAP protein is associated with p120 RasGAP in growth-factor stimulated and tyrosine kinase transformed cells. It functions as a GTPase - activating protein (GAP) for Rho and Rac family proteins, which are involved in regulating cytoskeletal actin and membrane ruffling. The antibody appears to couple signal transduction via Ras and Rho through its association with RasGAP. The presence of two adjacent SH2 domains in the p21 RAS GAP indicates that GAP might interact directly with tyrosine kinases.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q07960
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 392
Name Human RhoGAP (aa 304-431) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ARHGAP1; ARHGAP5; B230365D05Rik; C76222; CDC42 GTPase-activating protein; CDC42GAP; GFI2; growth factor independent 2; GTPase-activating protein rhoGAP; GTPase-activating protein rhoOGAP; GTPase-activating protein, Rho, 1; LOC512817 protein; p100 RasGAP-associated p105 protein; p105 RhoGAP; p190-B; p190BRhoGAP; p50rhoGAP; p50-RhoGAP; Rho GTPase activating protein 1; Rho GTPase activating protein 5; rho GTPase-activating protein 1; Rho GTPase-activating protein 5; RHOGAP; RHOGAP1; RHOGAP5; rho-related small GTPase protein activator; Rho-type GTPase-activating protein 1; rho-type GTPase-activating protein 5
Common Name RhoGAP
Gene Symbol ARHGAP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DFDQYNELHLPAVILKTFLRELPEPLLTFDLYPHVVGFLNIDESQRVPATLQVLQTLPEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFTKFLLDHQGELF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.