missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RNF128 (aa 300-422) Control Fragment Recombinant Protein

Product Code. 30210765
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210765

Brand: Invitrogen™ RP92127

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54054 (PA5-54054. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GRAIL is a type I transmembrane protein that localizes to the endocytic pathway and contains a PA (protease associated) domain and a RING-type zinc finger domain. It is a ubiquitin-protein isopeptide ligase (E3) necessary for the induction of CD4(+) T cell anergy in vivo and induced expression of this protein was observed in anergic CD4 (+) T cells, which suggested a role in the induction of anergic phenotype. It is differentially expressed in naturally occurring and peripherally induced CD25 (+) T regulatory cells and the expression is linked to the conversion of these cells to a regulatory phenotype. Expression of GRAIL in retrovirally transduced T cell hybridomas limits activation-induced IL-2 and IL-4 cytokine production. It also functions in the patterning of the dorsal ectoderm and sensitizes ectoderm to respond to neural-inducing signals.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8TEB7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79589
Name Human RNF128 (aa 300-422) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1300002C13Rik; AI987883; E3 ubiquitin-protein ligase RNF128; Gene related to anergy in lymphocytes protein; goliath-related E3 ubiquitin-protein ligase 1; Grail; Greul1; MNCb-3816; RGD1566282; RING finger protein 128; ring finger protein 128, E3 ubiquitin protein ligase; RING-type E3 ubiquitin transferase RNF128; RNF128; RP11-150F24.1
Common Name RNF128
Gene Symbol RNF128
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HKTCVDPWLLEHRTCPMCKCDILKALGIEVDVEDGSVSLQVPVSNEISNSASSHEEDNRSETASSGYASVQGTDEPPLEEHVQSTNESLQLVNHEANSVAVDVIPHVDNPTFEEDETPNQETA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.