missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30213173

Invitrogen™ Human RNF19A (aa 100-159) Control Fragment Recombinant Protein

Product Code. 30213173
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30213173

Brand: Invitrogen™ RP93729

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54861 (PA5-54861. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the ring between ring fingers (RBR) protein family, and the encoded protein contains two RING-finger motifs and an in between RING fingers motif. This protein is an E3 ubiquitin ligase that is localized to Lewy bodies, and ubiquitylates synphilin-1, which is an interacting protein of alpha synuclein in neurons. The encoded protein may be involved in amyotrophic lateral sclerosis and Parkinson's disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013].
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NV58
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 25897
Name Human RNF19A (aa 100-159) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA032313; Dorfin; Double ring-finger protein; E3 ubiquitin-protein ligase RNF19A; Gametogenesis-expressed protein GEG-154; Geg-154; p38; protein p38 interacting with transcription factor Sp1; ring finger protein (C3HC4 type) 19; ring finger protein 19; ring finger protein 19 A; ring finger protein 19 A, E3 ubiquitin protein ligase; ring finger protein 19 A, RBR E3 ubiquitin protein ligase; ring-IBR-ring domain containing protein Dorfin; Rnf19; RNF19A; Ubce7ip2; UBCM4-interacting protein 117; ubiquitin conjugating enzyme 7 interacting protein 2; UIP117; XY body protein; XYbp
Common Name RNF19A
Gene Symbol RNF19A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EMCTDKNSIFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVDCL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.