missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210265

Invitrogen™ Human RNF40 (aa 569-625) Control Fragment Recombinant Protein

Product Code. 30210265
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210265

Brand: Invitrogen™ RP104993

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84188 (PA5-84188. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene contains a RING finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein was reported to interact with the tumor suppressor protein RB1. Studies of the rat counterpart suggested that this protein may function as an E3 ubiquitin-protein ligase, and facilitate the ubiquitination and degradation of syntaxin 1, which is an essential component of the neurotransmitter release machinery.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O75150
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9810
Name Human RNF40 (aa 569-625) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 95 kDa retinoblastoma protein binding protein; 95 kDa retinoblastoma-associated protein; AI848422; BRE1 E3 ubiquitin ligase homolog B; Bre1b; BRE1-B; DKFZp686K191; E3 ubiquitin-protein ligase BRE1B; KIAA0661; MGC13051; mKIAA0661; protein staring; Rb-associated protein; RBP95; RING finger protein 40; ring finger protein 40, E3 ubiquitin protein ligase; RING-type E3 ubiquitin transferase BRE1B; Rnf40; STARING; staring protein; syntaxin-1-interacting RING finger protein
Common Name RNF40
Gene Symbol RNF40
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GTTTTTTSVKKEELVPSEEDFQGITPGAQGPSSRGREPEARPKRELREREGPSLGPP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.