missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RyR2 (aa 4339-4440) Control Fragment Recombinant Protein

Product Code. 30210856
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210856

Brand: Invitrogen™ RP91295

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82709 (PA5-82709. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Dihydropyridine receptor (DHPR) is a surface membrane protein critical for the excitation-contraction coupling of striated muscle. DHPR and the sarcoplasmic reticulum ryanodine receptor (RyR) are two key components of the intracellular junctions, where depolarization of the surface membrane is converted into the release of Ca2+ from internal stores. The alpha1-subunit of the DHPR contains a cytoplasmic loop which is thought to be involved in the interactions with RyR. Phosphorylation of the DHPR alpha1-subunit is also thought to play a role in the functional interaction of DHPR and RyR. Mutation in DHPR alpha1 results in excitation-contraction uncoupling, leading to muscular dysgenesis, a complete inactivity in developing skeletal muscles. Cells that do not express RyR also lack excitation-contraction coupling and exhibit a severalfold reduction in Ca2+ current density.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q92736
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6262
Name Human RyR2 (aa 4339-4440) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9330127I20Rik; ARVC2; ARVD2; calcium release channel; cardiac muscle ryanodine receptor; Cardiac muscle ryanodine receptor-calcium release channel; cardiac ryanodine receptor 2; cardiac-type ryanodine receptor; hRYR-2; islet-type ryanodine receptor; kidney-type ryanodine receptor; Ryanodine receptor; ryanodine receptor 2; ryanodine receptor 2 (cardiac); ryanodine receptor 2, cardiac; ryanodine receptor type 2; ryanodine receptor type II; RyR; RYR2; RYR-2; Type 2 ryanodine receptor; VTSIP
Common Name RyR2
Gene Symbol Ryr2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QDEVRGDGEEGERKPLEAALPSEDLTDLKELTEESDLLSDIFGLDLKREGGQYKLIPHNPNAGLSDLMSNPVPMPEVQEKFQEQKAKEEEKEEKEETKSEPE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.