missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210666

Invitrogen™ Human SDCCAG8 (aa 2-91) Control Fragment Recombinant Protein

Product Code. 30210666
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210666

Brand: Invitrogen™ RP107882

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111696 (PA5-111696. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SDCCAG8 (serologically defined colon cancer antigen 8), also known as CCCAP (centrosomal colon cancer autoantigen protein), HSPC085 or NY-CO-8, is a 713 amino acid cytoplasmic protein that is expressed in thymus, prostate, testis, ovary, small intestine, colon, mucosa and renal cancer tumors. Existing as a homodimer, SDCCAG8 localizes to centrioles and interacts with oral-facial-digital syndrome 1 (ODF1), which is associated with nephronophthisis-related ciliopathies (NPHP-RC), a recessive disorder that is characterized by dysplasia or degeneration of the kidney, retina and cerebellum. SDCCAG8 exists as four alternatively spliced isoforms and is encoded by a gene located on humanc chromosome 1, which spans 260 million base pairs, contains over 3,000 genes and comprises nearly 8% of the human genome.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q86SQ7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10806
Name Human SDCCAG8 (aa 2-91) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2700048G21Rik; 5730470G24Rik; Antigen NY-CO-8; BBS16; CCCAP; CCCAP SLSN7; centrosomal colon cancer autoantigen protein; hCCCAP; HSPC085; mCCCAP; NPHP10; NY-CO-8; SDCCAG8; Serologically defined colon cancer antigen 8; serologically defined colon cancer antigen 8 homolog; SHH signaling and ciliogenesis regulator sdccag8; si:dkey-60b15.1; slinky; SLSN7
Common Name SDCCAG8
Gene Symbol SDCCAG8
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AKSPENSTLEEILGQYQRSLREHASRSIHQLTCALKEGDVTIGEDAPNLSFSTSVGNEDARTAWPELQQSHAVNQLKDLLRQQADKESEV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.