missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30204797

Invitrogen™ Human SIGLEC11 (aa 668-698) Control Fragment Recombinant Protein

Product Code. 30204797
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30204797 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30204797 Supplier Invitrogen™ Supplier No. RP101402

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (37%), Rat (37%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-139815 (PA5-139815, PA5-63831 (PA5-63831. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Siglecs are sialic acid-binding lectins of the immunoglobulin superfamily that are mainly expressed in cells of the hematopoietic system. Siglec11 is unlike other siglecs in that it binds specifically to alpha2-8-linked sialic acids and is not found in peripheral blood leukocytes but instead on macrophages of various tissues. Siglec11 is highly homologous to Siglec10 over their extracellular domain but not over their cytoplasmic domain, suggesting that Siglec11 arose through gene duplication followed by a recombination event involving another ancestral siglec gene. Following treatment of Siglec11-transfected cells with pervanadate, Siglec11 becomes tyrosine-phosphorylated and strongly associates with SHP-1 and SHP-2. At least five isoforms of Siglec11 are known to exist.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96RL6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 114132
Name Human SIGLEC11 (aa 668-698) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias sialic acid binding Ig like lectin 11; sialic acid binding Ig-like lectin 11; sialic acid-binding Ig-like lectin 11; Sialic acid-binding lectin 11; Siglec; SIGLEC11; siglec-11; UNQ9222/PRO28718
Common Name SIGLEC11
Gene Symbol SIGLEC11
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YSEIKIHTGQPLRGPGFGLQLEREMSGMVPK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.