missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200200

Invitrogen™ Human SLC10A7 (aa 323-358) Control Fragment Recombinant Protein

Product Code. 30200200
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200200

Brand: Invitrogen™ RP105086

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (33%), Rat (33%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66110 (PA5-66110. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SLC10A7 (solute carrier family 10 (sodium/bile acid cotransporter family), member 7), also known as P7, is a 358 amino acid multi-pass membrane protein belonging to the sodium:bile acid symporter family. Existing as seven alternatively spliced isoforms, SLC10A7 is expressed at high levels in liver and lung, moderate levels in placenta, kidney, spleen, and thymus, and low levels in heart, prostate, and testis. A few members of the sodium:bile acid symporter family, such as NTCP (also known as SLC10A1) and Asbt (also known as SLC10A2), are involved in maintaining enterohepatic circulation of bile acids by mediating the first step of active bile transport through membrane barriers of liver and intestine. Other family members, including SLC10A6, play an important role in the cellular delivery of specific prohormones in testis, placenta, adrenal gland and other peripheral tissues. Orphan carriers such as SLC10A7 are uncharacterized and their functions unknown.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q0GE19
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 84068
Name Human SLC10A7 (aa 323-358) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2410193C02Rik; C4orf13; Na(+)/bile acid cotransporter 7; P7; PSEC0051; SBF-domain containing protein; SLC10A7; Sodium/bile acid cotransporter 7; solute carrier family 10 (sodium/bile acid cotransporter family), member 7; solute carrier family 10 (sodium/bile acid cotransporter family), member 7-like; solute carrier family 10 member 7; solute carrier family 10, member 7
Common Name SLC10A7
Gene Symbol SLC10A7
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KSWMVSRQKKLLQTRGPLANLNNPEGLEYLSIKFGH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.