missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30213230

Invitrogen™ Human SLC11A1 (aa 25-56) Control Fragment Recombinant Protein

Product Code. 30213230
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30213230

Brand: Invitrogen™ RP95951

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56201 (PA5-56201. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NRAMP1, also known as SLC11A1, is a member of the solute carrier family 11 (proton-coupled divalent metal ion transporters) family and encodes a multi-pass membrane protein. The protein functions as a divalent transition metal (iron and manganese) transporter involved in iron metabolism and host resistance to certain pathogens. Mutations in this gene have been associated with susceptibility to infectious diseases such as leprosy and tuberculosis, and inflammatory diseases such as Crohn disease and rheumatoid arthritis. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P49279
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6556
Name Human SLC11A1 (aa 25-56) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Bcg; host resistance locus Bcg/Ity/Lsh; integral membrane protein; Itg; Ity; Lsh; natural resistance associated macrophage protein; natural resistance associated macrophage protein 1; natural resistance-associated macrophage protein; natural resistance-associated macrophage protein 1; natural resistance-associated macrophages protein 1; NRAMP; NRAMP 1; Nramp1; Slc11a1; solute carrier 11 family member 1; solute carrier family 11 (proton-coupled divalent metal ion transporter), member 1; solute carrier family 11 (proton-coupled divalent metal ion transporters), member 1; solute carrier family 11 (sodium/phosphate symporters), member 1; solute carrier family 11 A1; solute carrier family 11 member 1; solute carrier family 11 member a1
Common Name SLC11A1
Gene Symbol SLC11A1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TSPGPQQAPPRETYLSEKIPIPDTKPGTFSLR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.