missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SLC9A7 (aa 533-602) Control Fragment Recombinant Protein

Product Code. 30206882
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206882

Brand: Invitrogen™ RP108044

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67384 (PA5-67384. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Na+/H+ exchangers (NHE) of mammalian cells are plasma membrane intrinsic proteins mediating exchange of N+ and H+ ions in various tissues. The NHE catalyzes the electroneural transport of extracellular Na+ for intracellular H+. They play a major role in regulation of intracellular pH (pHi) in addition to trans-cellular absorption of Na+, cell volume regulation and possibly in cell proliferation. These primary functions of the Na+/H+ exchanger have been related to many pathophysiological states, include hypertension, organ growth and hypertrophy, regression of cancer and renal intestinal disorders. At least 7 NHE isoforms (NHE1-7) have been cloned so far. They are all similar in their primary structure and predicted to have 10-12 transmembrane domains. The C-terminal domain of NHEs are predicted to be intracellular. NHE7 (human 725 aa, chromosome Xp11.4) is ubiquitously expressed, and predominantly localizes to the trans-golgi network. NHE7 mediates the influx of Na+ or K+ in exchange for H+. It is ∽70% related to NHE6 but relatively less (∽25%) homologous with other NHEs.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96T83
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 84679
Name Human SLC9A7 (aa 533-602) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A530087D17Rik; hypothetical protein LOC554532; Na(+)/H(+) exchanger 7; Nhe7; NHE-7; nonselective sodium potassium/proton exchanger; SLC9A6; Slc9a7; Sodium/hydrogen exchanger 7; solute carrier family 9 (sodium/hydrogen exchanger), isoform 7; solute carrier family 9 (sodium/hydrogen exchanger), member 7; solute carrier family 9 member 7; solute carrier family 9 member A7; solute carrier family 9, subfamily A (NHE7, cation proton antiporter 7), member 7; wu:fk03b09; zgc:101088; zgc:113878
Common Name SLC9A7
Gene Symbol SLC9A7
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SWLNIRVGVEEPSEEDQNEHHWQYFRVGVDPDQDPPPNNDSFQVLQGDGPDSARGNRTKQESAWIFRLWY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.