missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30181906

Invitrogen™ Human SNRPA (aa 93-165) Control Fragment Recombinant Protein

Product Code. 30181906
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30181906

Brand: Invitrogen™ RP98877

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61243 (PA5-61243. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene associates with stem loop II of the U1 small nuclear ribonucleoprotein, which binds the 5' splice site of precursor mRNAs and is required for splicing. The encoded protein autoregulates itself by polyadenylation inhibition of its own pre-mRNA via dimerization and has been implicated in the coupling of splicing and polyadenylation.
TRUSTED_SUSTAINABILITY

Especificaciones

Accession Number P09012
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6626
Name Human SNRPA (aa 93-165) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C430021M15Rik; fc19d01; MGC137110 protein; Mud1; nRNP A; nuclear ribonucleoprotein A; protein A of the U1 small nuclear RNA; Rnu1a1; Rnu1a-1; small nuclear ribonucleoprotein polypeptide A; Snrpa; U1 small nuclear ribonucleoprotein A; U1 small nuclear RNP-specific A; U1 snRNP A; U1 snRNP protein A; U1 snRNP-specific protein A; U1A; U1-A; Unknown (protein for MGC:77810); wu:fc19d01; zgc:77810
Common Name SNRPA
Gene Symbol SNRPA
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPYMP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado