missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30199720

Invitrogen™ Human SOX9 (aa 392-508) Control Fragment Recombinant Protein

Product Code. 30199720
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199720

Brand: Invitrogen™ RP100725

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81966 (PA5-81966. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SOX9 has a role in sex determination and differentiation of Sertoli cells. It is involved in chondrogenesis and regulates the expression of other genes involved in chondrogenesis by acting as a transcription factor for these genes. Translocation of this gene can cause campomelic dysplasia. SOX9 is involved in the formation of testes from the indifferent fetal gonads. It is a major molecular component of the neuron-glia switch in developing spinal cord. During normal development, SOX9 allows the prostate epithelium to outgrow into the mesenchyme and then provides basal cell support for development and maintenance of the luminal epithelium. These functions of SOX9 are subverted in prostate cancer to support tumor growth and invasion. SOX9 may direct the formation of neural crest precursors and the development of a range of neural crest derivative. It has a transcriptional regulation in melanin production in cells. Northern blot analysis shows its expression on adult testis, adult heart, and fetal brain.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P48436
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6662
Name Human SOX9 (aa 392-508) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2010306G03Rik; AV220920; CMD1; CMPD1; mKIAA4243; SOX 9; So x 9; SOX-9; So x 9 transcription factor; SRA1; SRX x 2; SRXY10; SRY (sex determining region Y)-box 9; SRY (sex determining region Y)-box 9 (campomelic dysplasia, autosomal sex-reversal); SRY (sex determining region Y)-bo x 9; SRY (sex-determining region Y)-box 9 protein; SRY box 9; SRY-box 9; SRY-Box 9 ; SRY-box containing 9; SRY-box containing gene 9; SRY-box containing protein 9; SRY-box transcription factor 9; SRY-related HMG-box, gene 9; transcription activator So x 9; transcription factor SOX-9
Common Name SOX9
Gene Symbol SOX9
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.