missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30206184

Invitrogen™ Human SPATA20 (aa 647-756) Control Fragment Recombinant Protein

Product Code. 30206184
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30206184 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30206184 Supplier Invitrogen™ Supplier No. RP93214

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55523 (PA5-55523. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein may play a role in fertility regulation. It were significantly upregulated in individual bile samples from Cholangiocarcinoma patients by Western blotting and Immunohistochemistry, relative to normal tissues. It acts as a potential serum diagnostic biomarker for Cholangiocarcinoma.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8TB22
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 64847
Name Human SPATA20 (aa 647-756) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias epididymis secretory protein Li 98; HEL-S-98; Spata20; sperm protein SSP411; spermatogenesis associated 20; spermatogenesis-associated protein 20; sperm-specific protein 411; SSP411; Tisp78; transcript increased in spermiogenesis 78; transcript increased in spermiogenesis 78 protein
Common Name SPATA20
Gene Symbol SPATA20
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SVSAHNLLRLHGFTGHKDWMDKCVCLLTAFSERMRRVPVALPEMVRALSAQQQTLKQIVICGDRQAKDTKALVQCVHSVYIPNKVLILADGDPSSFLSRQLPFLSTLRRL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.