missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30195859

Invitrogen™ Human SQSTM1 (aa 261-344) Control Fragment Recombinant Protein

Product Code. 30195859
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30195859

Brand: Invitrogen™ RP108545

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a multifunctional protein that binds ubiquitin and regulates activation of the nuclear factor kappa-B signaling pathway. The protein functions as a scaffolding/adaptor protein in concert with TNF receptor-associated factor 6 to mediate activation of NF-kB in response to upstream signals. Alternatively spliced transcript variants encoding either the same or different isoforms have been identified for this gene. Mutations in this gene result in sporadic and familial Paget disease of bone.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q13501
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8878
Name Human SQSTM1 (aa 261-344) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A170; EBI3-associated protein of 60 kDa; EBI3-associated protein p60; EBIAP; FTDALS3; hypothetical protein 1; ORCA; OSF-6; Osi; OSIL; oxidative stress induced; oxidative stress induced like; p60; p62; p62B; PDB3; phosphotyrosine independent ligand for the Lck SH2 domain p62; phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa; PKC-zeta-interacting protein; protein kinase C-zeta-interacting protein; sb:cb621; Sequestosome 1; sequestosome-1; Sqstm1; STAP; STONE14; ubiquitin-binding protein p62; Unknown (protein for MGC:127197); zgc:85784; ZIP; ZIP3
Common Name SQSTM1
Gene Symbol Sqstm1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.