missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ST3GAL6 (aa 42-148) Control Fragment Recombinant Protein

Product Code. 30203942
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203942

Brand: Invitrogen™ RP89966

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53845 (PA5-53845. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Sialyltransferases catalyze the transfer of sialic acid from cytidine 5-prime monophospho-N-acetylneuraminic acid (CMP-NeuAc) to terminal positions of glycoprotein and glycolipid carbohydrate groups. Terminal NeuAc residues are key determinants of carbohydrate structures, such as the sialyl-Lewis X determinants, and are widely distributed in many cell types. However, cancer cells often express more heavily sialylated glycans on their cell surface and this feature sometimes correlates with invasiveness. In contrast, expression of ST3gal6, a member of the sialyltransferase family that sialylates type II lactosamine structures on glycoproteins and glycolipids, was found to be significantly decreased by hypermethylation of the gene in gastrointestinal cancer. At least three isoforms of ST3gal6 are known to exist.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y274
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10402
Name Human ST3GAL6 (aa 42-148) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700023B24Rik; AI930218; alpha2,3-sialyltransferase ST3Gal VI; alpha-2,3-sialyltransferase VI; AW552396; CMP-NeuAc:beta-galactoside alpha-2,3-sialyltransferase VI; sia10; Sialyltransferase 10; sialyltransferase 10 (alpha-2,3-sialyltransferase VI); SIAT10; ST3 beta-galactoside alpha-2,3-sialyltransferase 6; ST3Gal VI; ST3GAL6; ST3GalVI; type 2 lactosamine alpha-2,3-sialyltransferase
Common Name ST3GAL6
Gene Symbol ST3GAL6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IQPCLSKPAFASLLRFHQFHPFLCAADFRKIASLYGSDKFDLPYGMRTSAEYFRLALSKLQSCDLFDEFDNIPCKKCVVVGNGGVLKNKTLGEKIDSYDVIIRMNNG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.